SCOPe 2.08: Domain d4mbua1: 4mbu A:1-162

Lineage for d4mbua1 (4mbu A:1-162)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [259363] (2 PDB entries)

8. Domain d4mbua1: 4mbu A:1-162 [263011]
   Other proteins in same PDB: d4mbua2
   automated match to d3dr8b_
   complexed with cd, po4

Details for d4mbua1

PDB Entry: 4mbu, 2.15 Å

PDB Description: crystal structure of n-acetyltransferase from staphylococcus aureus mu50

PDB Compounds: (A:) Similar to N-acetyltransferase

SCOPe Domain Sequences for d4mbua1:

Sequence; same for both SEQRES and ATOM records:

>d4mbua1 d.108.1.0 (A:1-162) automated matches {Staphylococcus aureus [TaxId: 158878]}
mircakkedlnailaiyndaiinttavytykpqtideriawfetkqrnhepifvfeengs
vlgfatfgsfrpwpayqytiehsiyvdasargkgiasqllqrliveakakgyrtlvagid
asneasiklhqkfnfkhagtltnvgykfdywldlafyeldlk

Timeline for d4mbua1:

• d4mbua1 first appeared in SCOPe 2.05, called d4mbua_
  
• d4mbua1 appears in SCOPe 2.07