Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (21 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188855] (3 PDB entries) |
Domain d4mbed_: 4mbe D: [263010] Other proteins in same PDB: d4mbec_, d4mbef_ automated match to d3fwba_ protein/RNA complex; complexed with ca |
PDB Entry: 4mbe (more details), 2.61 Å
SCOPe Domain Sequences for d4mbed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mbed_ a.39.1.5 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydseg rhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltde elramieefdldgdgeinenefiaictds
Timeline for d4mbed_: