Lineage for d4m85d1 (4m85 D:1-182)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2210005Species Staphylococcus aureus [TaxId:158878] [259363] (2 PDB entries)
  8. 2210009Domain d4m85d1: 4m85 D:1-182 [263006]
    Other proteins in same PDB: d4m85a2, d4m85b2, d4m85c2, d4m85d2
    automated match to d4m85a_

Details for d4m85d1

PDB Entry: 4m85 (more details), 2 Å

PDB Description: crystal structure of n-acetyltransferase from staphylococcus aureus mu50
PDB Compounds: (D:) n-acetyltransferase

SCOPe Domain Sequences for d4m85d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m85d1 d.108.1.0 (D:1-182) automated matches {Staphylococcus aureus [TaxId: 158878]}
mirqarpedrfdiaklvymvwddmelelvkhlpkdmvldaiekscvdatyrtfyqhilvy
evenkvagciisysgenelkyekawelldlpeeikqygtplpvkeakddeyyietiatfa
ayrgrgiatklltsllesnthvkwslncdinneaalklykkvgfisdgqielykhmyhhl
iv

SCOPe Domain Coordinates for d4m85d1:

Click to download the PDB-style file with coordinates for d4m85d1.
(The format of our PDB-style files is described here.)

Timeline for d4m85d1: