SCOPe 2.05: Domain d1klta_: 1klt A:

Lineage for d1klta_ (1klt A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Chymase (mast cell protease I) [89343] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89344] (11 PDB entries)

8. Domain d1klta_: 1klt A: [26300]
   complexed with pms

Details for d1klta_

PDB Entry: 1klt, 1.9 Å

PDB Description: crystal structure of pmsf-treated human chymase at 1.9 angstroms resolution

PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d1klta_:

Sequence; same for both SEQRES and ATOM records:

>d1klta_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteskphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqfnfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagvaqgivsygrsdakppavftrishyrpwinqilqan

Timeline for d1klta_:

• d1klta_ first appeared (with stable ids) in SCOP 1.55, called d1klt__
  
• d1klta_ appears in SCOPe 2.04
  
• d1klta_ appears in SCOPe 2.06
  
• d1klta_ appears in the current release, SCOPe 2.08