Lineage for d4m3kb1 (4m3k B:2-119)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (145 PDB entries)
  8. 2347672Domain d4m3kb1: 4m3k B:2-119 [262999]
    Other proteins in same PDB: d4m3ka_, d4m3kb2
    automated match to d4m3ja_
    complexed with cl

Details for d4m3kb1

PDB Entry: 4m3k (more details), 1.48 Å

PDB Description: Structure of a single domain camelid antibody fragment cAb-H7S in complex with the BlaP beta-lactamase from Bacillus licheniformis
PDB Compounds: (B:) Camelid heavy-chain antibody variable fragment cAb-H7S

SCOPe Domain Sequences for d4m3kb1:

Sequence, based on SEQRES records: (download)

>d4m3kb1 b.1.1.1 (B:2-119) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqpggslrlscaasgsissittmgwyrqdpgkgrelvalinsvgdttyag
svkgrftisrdnakntvylemsslkpedtavyycnafmstnsgrtgsfwgqgtqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d4m3kb1 b.1.1.1 (B:2-119) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqpggslrlscaasgsissittmgwyrqdgrelvalinsvgdttyagsvk
grftisrdnakntvylemsslkpedtavyycnafmstnsgrtgsfwgqgtqvtvs

SCOPe Domain Coordinates for d4m3kb1:

Click to download the PDB-style file with coordinates for d4m3kb1.
(The format of our PDB-style files is described here.)

Timeline for d4m3kb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4m3kb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4m3ka_