Lineage for d4m3jb1 (4m3j B:6-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743780Domain d4m3jb1: 4m3j B:6-118 [262998]
    Other proteins in same PDB: d4m3ja2, d4m3jb2, d4m3jb3
    automated match to d4m3ja_
    complexed with so4

Details for d4m3jb1

PDB Entry: 4m3j (more details), 1.95 Å

PDB Description: Structure of a single-domain camelid antibody fragment cAb-H7S specific of the BlaP beta-lactamase from Bacillus licheniformis
PDB Compounds: (B:) Camelid heavy-chain antibody variable fragment cAb-H7S

SCOPe Domain Sequences for d4m3jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m3jb1 b.1.1.1 (B:6-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgsissittmgwyrqdpgkgrelvalinsvgdttyagsvkg
rftisrdnakntvylemsslkpedtavyycnafmstnsgrtgsfwgqgtqvtv

SCOPe Domain Coordinates for d4m3jb1:

Click to download the PDB-style file with coordinates for d4m3jb1.
(The format of our PDB-style files is described here.)

Timeline for d4m3jb1: