Lineage for d4lu5l2 (4lu5 L:113-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (649 PDB entries)
  8. 2753268Domain d4lu5l2: 4lu5 L:113-219 [262987]
    Other proteins in same PDB: d4lu5h_, d4lu5i_, d4lu5l1, d4lu5m1
    automated match to d3mbxl2

Details for d4lu5l2

PDB Entry: 4lu5 (more details), 2.9 Å

PDB Description: structure of murine igg2a a20g2-fab in complex with vaccinia antigen a33r at the resolution of 2.9 angstroms
PDB Compounds: (L:) Murine IgG2a A20G2 Light chain Fab domain

SCOPe Domain Sequences for d4lu5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lu5l2 b.1.1.2 (L:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d4lu5l2:

Click to download the PDB-style file with coordinates for d4lu5l2.
(The format of our PDB-style files is described here.)

Timeline for d4lu5l2: