SCOPe 2.08: Domain d4lu5l1: 4lu5 L:1-112

Lineage for d4lu5l1 (4lu5 L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4lu5l1: 4lu5 L:1-112 [262986]
   Other proteins in same PDB: d4lu5h_, d4lu5i_, d4lu5l2, d4lu5m2
   automated match to d2g2ra1

Details for d4lu5l1

PDB Entry: 4lu5, 2.9 Å

PDB Description: structure of murine igg2a a20g2-fab in complex with vaccinia antigen a33r at the resolution of 2.9 angstroms

PDB Compounds: (L:) Murine IgG2a A20G2 Light chain Fab domain

SCOPe Domain Sequences for d4lu5l1:

Sequence; same for both SEQRES and ATOM records:

>d4lu5l1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlkisrveaedlgiyycvqgthfpytfgggtkleik

Timeline for d4lu5l1:

• d4lu5l1 first appeared in SCOPe 2.05
  
• d4lu5l1 appears in SCOPe 2.07