SCOPe 2.06: Domain d4ltub_: 4ltu B:

Lineage for d4ltub_ (4ltu B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (21 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:316058] [260314] (1 PDB entry)

8. Domain d4ltub_: 4ltu B: [262985]
   automated match to d4ltua_
   complexed with fes

Details for d4ltub_

PDB Entry: 4ltu, 2.31 Å

PDB Description: Crystal Structure of Ferredoxin from Rhodopseudomonas palustris HaA2

PDB Compounds: (B:) ferredoxin

SCOPe Domain Sequences for d4ltub_:

Sequence; same for both SEQRES and ATOM records:

>d4ltub_ d.15.4.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
psitfihpdgrseivdaaigdsamfaalnhgidsivaecggnavcatchvyvddlwlakl
ppvdaneddlldgtasdrlpnsrlscqikiapeldglvlriperqt

Timeline for d4ltub_:

• d4ltub_ first appeared in SCOPe 2.05
  
• d4ltub_ appears in SCOPe 2.07
  
• d4ltub_ appears in the current release, SCOPe 2.08