Lineage for d4ltub_ (4ltu B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894403Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 1894404Protein automated matches [191164] (14 species)
    not a true protein
  7. 1894470Species Rhodopseudomonas palustris [TaxId:316058] [260314] (1 PDB entry)
  8. 1894472Domain d4ltub_: 4ltu B: [262985]
    automated match to d4ltua_
    complexed with fes

Details for d4ltub_

PDB Entry: 4ltu (more details), 2.31 Å

PDB Description: Crystal Structure of Ferredoxin from Rhodopseudomonas palustris HaA2
PDB Compounds: (B:) ferredoxin

SCOPe Domain Sequences for d4ltub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ltub_ d.15.4.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
psitfihpdgrseivdaaigdsamfaalnhgidsivaecggnavcatchvyvddlwlakl
ppvdaneddlldgtasdrlpnsrlscqikiapeldglvlriperqt

SCOPe Domain Coordinates for d4ltub_:

Click to download the PDB-style file with coordinates for d4ltub_.
(The format of our PDB-style files is described here.)

Timeline for d4ltub_: