![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:316058] [260314] (1 PDB entry) |
![]() | Domain d4ltub_: 4ltu B: [262985] automated match to d4ltua_ complexed with fes |
PDB Entry: 4ltu (more details), 2.31 Å
SCOPe Domain Sequences for d4ltub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ltub_ d.15.4.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]} psitfihpdgrseivdaaigdsamfaalnhgidsivaecggnavcatchvyvddlwlakl ppvdaneddlldgtasdrlpnsrlscqikiapeldglvlriperqt
Timeline for d4ltub_: