Lineage for d4lrqd_ (4lrq D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874901Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2874902Protein automated matches [190574] (20 species)
    not a true protein
  7. 2874971Species Vibrio cholerae [TaxId:345073] [257854] (2 PDB entries)
  8. 2874975Domain d4lrqd_: 4lrq D: [262979]
    automated match to d2gi4a_
    complexed with mpo, so4

Details for d4lrqd_

PDB Entry: 4lrq (more details), 1.45 Å

PDB Description: crystal structure of a low molecular weight phosphotyrosine phosphatase from vibrio choleraeo395
PDB Compounds: (D:) Phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d4lrqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lrqd_ c.44.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 345073]}
mqkvlvvcmgnicrsptaeavlrakaaqlkvdvevdsagtigyhqgnppdarskaagekr
gysfsgikarkirdedfvkfdwilaadqenlaelkarcpqshqhklslmlshsdseyqei
pdpyyggergfelvldlvedaaeqfllk

SCOPe Domain Coordinates for d4lrqd_:

Click to download the PDB-style file with coordinates for d4lrqd_.
(The format of our PDB-style files is described here.)

Timeline for d4lrqd_: