![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.233: YfbU-like [116959] (1 superfamily) multihelical; consist of two subdomains; forms 24-mer with the N-terminal sudbomains packing around the 4-fold axis and the C-terminal domains interacting at the 2-fold and 3-fold axes |
![]() | Superfamily a.233.1: YfbU-like [116960] (1 family) ![]() automatically mapped to Pfam PF03887 |
![]() | Family a.233.1.1: YfbU-like [116961] (2 proteins) Pfam PF03887 |
![]() | Protein automated matches [257049] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [257050] (1 PDB entry) |
![]() | Domain d4lr3l_: 4lr3 L: [262972] automated match to d1wpba_ complexed with mg, po4 |
PDB Entry: 4lr3 (more details), 2.5 Å
SCOPe Domain Sequences for d4lr3l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lr3l_ a.233.1.1 (L:) automated matches {Escherichia coli [TaxId: 562]} memtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelkeetcr tiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegrythf dagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina
Timeline for d4lr3l_: