Lineage for d4lr3j_ (4lr3 J:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2019948Fold a.233: YfbU-like [116959] (1 superfamily)
    multihelical; consist of two subdomains; forms 24-mer with the N-terminal sudbomains packing around the 4-fold axis and the C-terminal domains interacting at the 2-fold and 3-fold axes
  4. 2019949Superfamily a.233.1: YfbU-like [116960] (1 family) (S)
    automatically mapped to Pfam PF03887
  5. 2019950Family a.233.1.1: YfbU-like [116961] (2 proteins)
    Pfam PF03887
  6. 2019969Protein automated matches [257049] (1 species)
    not a true protein
  7. 2019970Species Escherichia coli [TaxId:562] [257050] (1 PDB entry)
  8. 2019980Domain d4lr3j_: 4lr3 J: [262970]
    automated match to d1wpba_
    complexed with mg, po4

Details for d4lr3j_

PDB Entry: 4lr3 (more details), 2.5 Å

PDB Description: crystal structure of e. coli yfbu at 2.5 a resolution
PDB Compounds: (J:) protein YfbU

SCOPe Domain Sequences for d4lr3j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lr3j_ a.233.1.1 (J:) automated matches {Escherichia coli [TaxId: 562]}
memtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelkeetcr
tiidimemyhalhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegrythf
dagthgfnaqtpmwekyqrmlnvwhacprqyhlsaneinqiina

SCOPe Domain Coordinates for d4lr3j_:

Click to download the PDB-style file with coordinates for d4lr3j_.
(The format of our PDB-style files is described here.)

Timeline for d4lr3j_: