SCOPe 2.08: Domain d4lpzb_: 4lpz B:

Lineage for d4lpzb_ (4lpz B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187434] (30 PDB entries)

8. Domain d4lpzb_: 4lpz B: [262964]
   automated match to d1x0oa_

Details for d4lpzb_

PDB Entry: 4lpz, 3.15 Å

PDB Description: arnt transcription factor/coactivator complex

PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d4lpzb_:

Sequence, based on SEQRES records:

>d4lpzb_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tefisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvklkg
qvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnv

Sequence, based on observed residues (ATOM records):

>d4lpzb_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tefisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvklkg
qvlsvmfrfrsknqewlwmrtssftfieyiictntnv

Timeline for d4lpzb_:

• d4lpzb_ first appeared in SCOPe 2.05
  
• d4lpzb_ appears in SCOPe 2.07