SCOPe 2.06: Domain d4lmxj_: 4lmx J:

Lineage for d4lmxj_ (4lmx J:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (18 species)
   not a true protein

7. Species Hemiselmis andersenii [TaxId:464988] [257044] (1 PDB entry)

8. Domain d4lmxj_: 4lmx J: [262962]
   automated match to d4lmxb_
   complexed with dbv, peb

Details for d4lmxj_

PDB Entry: 4lmx, 1.8 Å

PDB Description: Light harvesting complex PE555 from the cryptophyte Hemiselmis andersenii CCMP644

PDB Compounds: (J:) cryptophyte phycoerythrin (beta chain)

SCOPe Domain Sequences for d4lmxj_:

Sequence; same for both SEQRES and ATOM records:

>d4lmxj_ a.1.1.3 (J:) automated matches {Hemiselmis andersenii [TaxId: 464988]}
dafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmvce
npsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyaslgv
paagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala

Timeline for d4lmxj_:

• d4lmxj_ first appeared in SCOPe 2.05
  
• d4lmxj_ appears in SCOPe 2.07
  
• d4lmxj_ appears in the current release, SCOPe 2.08