| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
| Protein automated matches [190531] (18 species) not a true protein |
| Species Hemiselmis andersenii [TaxId:464988] [257044] (1 PDB entry) |
| Domain d4lmxd_: 4lmx D: [262960] automated match to d4lmxb_ complexed with dbv, peb |
PDB Entry: 4lmx (more details), 1.8 Å
SCOPe Domain Sequences for d4lmxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lmxd_ a.1.1.3 (D:) automated matches {Hemiselmis andersenii [TaxId: 464988]}
dafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmvce
npsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyaslgv
paagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
Timeline for d4lmxd_: