Lineage for d4lmsa_ (4lms A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005102Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3005103Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 3005151Family d.184.1.0: automated matches [257038] (1 protein)
    not a true family
  6. 3005152Protein automated matches [257039] (1 species)
    not a true protein
  7. 3005153Species Chroomonas sp. [TaxId:3029] [257040] (1 PDB entry)
  8. 3005154Domain d4lmsa_: 4lms A: [262959]
    Other proteins in same PDB: d4lmsb_, d4lmsd_
    automated match to d4lmsc_
    complexed with cyc, dbv, m1v, p6g

Details for d4lmsa_

PDB Entry: 4lms (more details), 1.35 Å

PDB Description: light harvesting complex pc645 from the cryptophyte chroomonas sp. ccmp270
PDB Compounds: (A:) cryptophyte phycocyanin (alpha-1 chain)

SCOPe Domain Sequences for d4lmsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmsa_ d.184.1.0 (A:) automated matches {Chroomonas sp. [TaxId: 3029]}
rdaqlrapiveifdargcdaknaqytgpksndmnddqcvkvsmqkitvseataakklqef
iggkatainvpiissmtkky

SCOPe Domain Coordinates for d4lmsa_:

Click to download the PDB-style file with coordinates for d4lmsa_.
(The format of our PDB-style files is described here.)

Timeline for d4lmsa_: