![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries) |
![]() | Domain d4llli_: 4lll I: [262955] automated match to d4llla_ protein/DNA complex |
PDB Entry: 4lll (more details), 3.04 Å
SCOPe Domain Sequences for d4llli_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4llli_ a.4.5.0 (I:) automated matches {Staphylococcus aureus [TaxId: 1280]} ftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgp tvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlsee eneqmkanltkmlsslq
Timeline for d4llli_: