SCOPe 2.07: Domain d4lisc_: 4lis C:

Lineage for d4lisc_ (4lis C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Aspergillus nidulans [TaxId:227321] [256357] (1 PDB entry)

8. Domain d4lisc_: 4lis C: [262948]
   automated match to d4lisb_
   complexed with gol, iod, nad, udp, upg

Details for d4lisc_

PDB Entry: 4lis, 2.8 Å

PDB Description: Crystal Structure of UDP-galactose-4-epimerase from Aspergillus nidulans

PDB Compounds: (C:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d4lisc_:

Sequence; same for both SEQRES and ATOM records:

>d4lisc_ c.2.1.0 (C:) automated matches {Aspergillus nidulans [TaxId: 227321]}
psgsvlvtggtgyigsfttlalleagykvvvadnlynssaealnrielisgkkaefaqld
vtdeaafdkvfeahpdidsvihfaalkavgesgekpldyyhvnvygticllrsmvrhnvt
nivfsssatvygdatrfpdmipipehcplgptnpygntkfaielaitdvinaqrnnakka
gneteaakwngallryfnpagahpsgimgedpqgvpynllpllaqvatgkrekllvfgdd
yashdgtairdyihildladghlkalnylrannpgvrawnlgtgrgstvyemirafskav
grdlpyevaprragdvlnltsnptrantelgwkaqrtleqacedlwlwtknnpqgyrqqp
pael

Timeline for d4lisc_:

• d4lisc_ first appeared in SCOPe 2.05
  
• d4lisc_ appears in SCOPe 2.06
  
• d4lisc_ appears in the current release, SCOPe 2.08