Lineage for d4lf1d2 (4lf1 D:139-457)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838730Protein automated matches [226984] (16 species)
    not a true protein
  7. 2838900Species Rhodopseudomonas palustris [TaxId:258594] [257017] (3 PDB entries)
  8. 2838921Domain d4lf1d2: 4lf1 D:139-457 [262942]
    Other proteins in same PDB: d4lf1a1, d4lf1b1, d4lf1c1, d4lf1d1, d4lf1e1, d4lf1f1
    automated match to d4lf1a2
    complexed with cap, mg

Details for d4lf1d2

PDB Entry: 4lf1 (more details), 2.38 Å

PDB Description: hexameric form ii rubisco from rhodopseudomonas palustris, activated and complexed with 2-cabp
PDB Compounds: (D:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d4lf1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lf1d2 c.1.14.1 (D:139-457) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwraklk

SCOPe Domain Coordinates for d4lf1d2:

Click to download the PDB-style file with coordinates for d4lf1d2.
(The format of our PDB-style files is described here.)

Timeline for d4lf1d2: