Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:258594] [257015] (3 PDB entries) |
Domain d4lf1c1: 4lf1 C:1-138 [262939] Other proteins in same PDB: d4lf1a2, d4lf1b2, d4lf1c2, d4lf1d2, d4lf1e2, d4lf1f2 automated match to d4lf1a1 complexed with cap, mg |
PDB Entry: 4lf1 (more details), 2.38 Å
SCOPe Domain Sequences for d4lf1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lf1c1 d.58.9.0 (C:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]} mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve yakmydfyvppaylklfd
Timeline for d4lf1c1: