Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
Protein automated matches [226984] (16 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:258594] [257017] (3 PDB entries) |
Domain d4lf1b2: 4lf1 B:139-453 [262938] Other proteins in same PDB: d4lf1a1, d4lf1b1, d4lf1c1, d4lf1d1, d4lf1e1, d4lf1f1 automated match to d4lf1a2 complexed with cap, mg |
PDB Entry: 4lf1 (more details), 2.38 Å
SCOPe Domain Sequences for d4lf1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lf1b2 c.1.14.1 (B:139-453) automated matches {Rhodopseudomonas palustris [TaxId: 258594]} gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf esfpqdadklypnwr
Timeline for d4lf1b2: