SCOPe 2.07: Domain d4lf1b2: 4lf1 B:139-453

Lineage for d4lf1b2 (4lf1 B:139-453)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein automated matches [226984] (16 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:258594] [257017] (3 PDB entries)

8. Domain d4lf1b2: 4lf1 B:139-453 [262938]
   Other proteins in same PDB: d4lf1a1, d4lf1b1, d4lf1c1, d4lf1d1, d4lf1e1, d4lf1f1
   automated match to d4lf1a2
   complexed with cap, mg

Details for d4lf1b2

PDB Entry: 4lf1, 2.38 Å

PDB Description: hexameric form ii rubisco from rhodopseudomonas palustris, activated and complexed with 2-cabp

PDB Compounds: (B:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d4lf1b2:

Sequence; same for both SEQRES and ATOM records:

>d4lf1b2 c.1.14.1 (B:139-453) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwr

Timeline for d4lf1b2:

• d4lf1b2 first appeared in SCOPe 2.05
  
• d4lf1b2 appears in SCOPe 2.06
  
• d4lf1b2 appears in the current release, SCOPe 2.08