Lineage for d4lemf_ (4lem F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141353Species Mycobacterium tuberculosis [TaxId:83332] [225379] (7 PDB entries)
  8. 2141363Domain d4lemf_: 4lem F: [262936]
    Other proteins in same PDB: d4lema2, d4lemb2, d4lemc2, d4lemd2, d4leme2
    automated match to d4e3xb_
    complexed with b12, mg

Details for d4lemf_

PDB Entry: 4lem (more details), 2.27 Å

PDB Description: crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis
PDB Compounds: (F:) 1-pyrroline-5-carboxylate dehydrogenase

SCOPe Domain Sequences for d4lemf_:

Sequence, based on SEQRES records: (download)

>d4lemf_ c.82.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgeridv
vqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwre
kiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpld
gfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvinl
vtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdfv
vahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdit
dlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptde
sfvieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaag
nfyvndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyphm
a

Sequence, based on observed residues (ATOM records): (download)

>d4lemf_ c.82.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgeridv
vqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwre
kiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpld
gfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvinl
vtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdfv
vahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdit
dlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddpsfv
ieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaagnfy
vndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyphma

SCOPe Domain Coordinates for d4lemf_:

Click to download the PDB-style file with coordinates for d4lemf_.
(The format of our PDB-style files is described here.)

Timeline for d4lemf_: