Lineage for d4lemd_ (4lem D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875571Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1875572Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1875981Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1875982Protein automated matches [190683] (38 species)
    not a true protein
  7. 1876244Species Mycobacterium tuberculosis [TaxId:83332] [225379] (7 PDB entries)
  8. 1876250Domain d4lemd_: 4lem D: [262934]
    automated match to d4e3xb_
    complexed with b12, mg

Details for d4lemd_

PDB Entry: 4lem (more details), 2.27 Å

PDB Description: crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis
PDB Compounds: (D:) 1-pyrroline-5-carboxylate dehydrogenase

SCOPe Domain Sequences for d4lemd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lemd_ c.82.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hmdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgerid
vvqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwr
ekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpl
dgfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvin
lvtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdf
vvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdi
tdlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptd
esfvieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaa
gnfyvndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyph
mavd

SCOPe Domain Coordinates for d4lemd_:

Click to download the PDB-style file with coordinates for d4lemd_.
(The format of our PDB-style files is described here.)

Timeline for d4lemd_: