![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (38 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [225379] (7 PDB entries) |
![]() | Domain d4lemb_: 4lem B: [262932] automated match to d4e3xb_ complexed with b12, mg |
PDB Entry: 4lem (more details), 2.27 Å
SCOPe Domain Sequences for d4lemb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lemb_ c.82.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} hmdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgerid vvqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwr ekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpl dgfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvin lvtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdf vvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdi tdlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptd esfvieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaa gnfyvndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyph mav
Timeline for d4lemb_: