Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (34 species) not a true protein |
Species Escherichia coli [TaxId:83333] [257011] (1 PDB entry) |
Domain d4lefg_: 4lef G: [262930] automated match to d2oqlb_ complexed with bgc, po4, zn |
PDB Entry: 4lef (more details), 1.84 Å
SCOPe Domain Sequences for d4lefg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lefg_ c.1.9.0 (G:) automated matches {Escherichia coli [TaxId: 83333]} sfdptgytlahehlhidlsgfknnvdcrldqyaficqemndlmtrgvrnviemtnrymgr naqfmldvmretginvvactgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkag iiaeigtsegkitpleekvfiaaalahnqtgrpisthtsfstmgleqlallqahgvdlsr vtvghcdlkdnldnilkmidlgayvqfdtigknsyypdekriamlhalrdrgllnrvmls mditrrshlkanggygydyllttfipqlrqsgfsqadvdvmlrenpsqffq
Timeline for d4lefg_: