Lineage for d4lefd_ (4lef D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442704Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2442705Protein automated matches [190150] (34 species)
    not a true protein
  7. 2442747Species Escherichia coli [TaxId:83333] [257011] (1 PDB entry)
  8. 2442751Domain d4lefd_: 4lef D: [262927]
    automated match to d2oqlb_
    complexed with bgc, po4, zn

Details for d4lefd_

PDB Entry: 4lef (more details), 1.84 Å

PDB Description: crystal structure of phosphotriesterase homology protein from escherichia coli complexed with phosphate in active site
PDB Compounds: (D:) phosphotriesterase homology protein

SCOPe Domain Sequences for d4lefd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lefd_ c.1.9.0 (D:) automated matches {Escherichia coli [TaxId: 83333]}
fdptgytlahehlhidlsgfknnvdcrldqyaficqemndlmtrgvrnviemtnrymgrn
aqfmldvmretginvvactgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkagi
iaeigtsegkitpleekvfiaaalahnqtgrpisthtsfstmgleqlallqahgvdlsrv
tvghcdlkdnldnilkmidlgayvqfdtigknsyypdekriamlhalrdrgllnrvmlsm
ditrrshlkanggygydyllttfipqlrqsgfsqadvdvmlrenpsqffq

SCOPe Domain Coordinates for d4lefd_:

Click to download the PDB-style file with coordinates for d4lefd_.
(The format of our PDB-style files is described here.)

Timeline for d4lefd_: