![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
![]() | Protein automated matches [190131] (86 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries) |
![]() | Domain d4le2d1: 4le2 D:1-129 [262924] Other proteins in same PDB: d4le2b2, d4le2c2, d4le2d2 automated match to d4le2a_ complexed with k, po4 |
PDB Entry: 4le2 (more details), 2.54 Å
SCOPe Domain Sequences for d4le2d1:
Sequence, based on SEQRES records: (download)
>d4le2d1 c.23.1.0 (D:1-129) automated matches {Bacillus subtilis [TaxId: 224308]} misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk riyapelme
>d4le2d1 c.23.1.0 (D:1-129) automated matches {Bacillus subtilis [TaxId: 224308]} misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk tgleaaeelkdtgckiiilttfyfqraikagvkgyllkdspseelanairsvmngkriya pelme
Timeline for d4le2d1: