SCOPe 2.08: Domain d4le2d1: 4le2 D:1-129

Lineage for d4le2d1 (4le2 D:1-129)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)

8. Domain d4le2d1: 4le2 D:1-129 [262924]
   Other proteins in same PDB: d4le2b2, d4le2c2, d4le2d2
   automated match to d4le2a_
   complexed with k, po4

Details for d4le2d1

PDB Entry: 4le2, 2.54 Å

PDB Description: crystal structure of the unphosphorylated receiver domain of desr in the active state

PDB Compounds: (D:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d4le2d1:

Sequence, based on SEQRES records:

>d4le2d1 c.23.1.0 (D:1-129) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelme

Sequence, based on observed residues (ATOM records):

>d4le2d1 c.23.1.0 (D:1-129) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfyfqraikagvkgyllkdspseelanairsvmngkriya
pelme

Timeline for d4le2d1:

• d4le2d1 first appeared in SCOPe 2.05, called d4le2d_
  
• d4le2d1 appears in SCOPe 2.07