![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
![]() | Protein automated matches [190029] (6 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [257827] (2 PDB entries) |
![]() | Domain d4lbqd_: 4lbq D: [262920] automated match to d4ga9a_ complexed with gol |
PDB Entry: 4lbq (more details), 2.4 Å
SCOPe Domain Sequences for d4lbqd_:
Sequence, based on SEQRES records: (download)
>d4lbqd_ b.29.1.3 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} cglvasnlnlkpgeclkvrgevasdaksfvlnlgkdsnnlclhfnprfnahgdantivcn tkedgtwgtehrepafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainyma adgdfkikcvafe
>d4lbqd_ b.29.1.3 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} cglvasnlnlkpgeclkvrgevasdaksfvlnlgkdsnnlclhfnprfntivcntkedgt wgtehrepafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainymaadgdfk ikcvafe
Timeline for d4lbqd_: