SCOPe 2.08: Domain d4lbqb_: 4lbq B:

Lineage for d4lbqb_ (4lbq B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein automated matches [190029] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [257827] (2 PDB entries)

8. Domain d4lbqb_: 4lbq B: [262918]
   automated match to d4ga9a_
   complexed with gol

Details for d4lbqb_

PDB Entry: 4lbq, 2.4 Å

PDB Description: crystal structure of mouse galectin-1

PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d4lbqb_:

Sequence, based on SEQRES records:

>d4lbqb_ b.29.1.3 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cglvasnlnlkpgeclkvrgevasdaksfvlnlgkdsnnlclhfnprfnahgdantivcn
tkedgtwgtehrepafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainyma
adgdfkikcvafe

Sequence, based on observed residues (ATOM records):

>d4lbqb_ b.29.1.3 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cglvasnlnlkpgeclkvrgevasdaksfvlnlgkdsnnlclhfnprfantivcntkedg
twgtehrepafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainymaadgdf
kikcvafe

Timeline for d4lbqb_:

• d4lbqb_ first appeared in SCOPe 2.05
  
• d4lbqb_ appears in SCOPe 2.07