Lineage for d4la4b_ (4la4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102815Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2102816Protein automated matches [190158] (24 species)
    not a true protein
  7. 2102903Species Pseudomonas sp. [TaxId:165468] [256995] (2 PDB entries)
  8. 2102909Domain d4la4b_: 4la4 B: [262917]
    automated match to d4la4a_

Details for d4la4b_

PDB Entry: 4la4 (more details), 2.07 Å

PDB Description: Crystal structure of native PnpB
PDB Compounds: (B:) NAD(P)H dehydrogenase (quinone)

SCOPe Domain Sequences for d4la4b_:

Sequence, based on SEQRES records: (download)

>d4la4b_ c.23.5.0 (B:) automated matches {Pseudomonas sp. [TaxId: 165468]}
ptkiqivfyssyghiykmaeaiaagarevgdvevtllqvpelmpeevqvksgikgyraaf
gsipyatpevlaeadaiifgtptrfgnmcsqmrnfldqtgglwmsggligkvgsvftsta
sqhggqettitsfhttllhhgmvivgvpysepgltnmteisggtpygastlagadgsrqp
senelqiarfqgkhvatiakrlannk

Sequence, based on observed residues (ATOM records): (download)

>d4la4b_ c.23.5.0 (B:) automated matches {Pseudomonas sp. [TaxId: 165468]}
ptkiqivfyssyghiykmaeaiaagarevgdvevtllqvpegsipyatpevlaeadaiif
gtptrfgnmcsqmrnfldqtgglwmsggligkvgsvftstasqhggqettitsfhttllh
hgmvivgvpysepgltnmteisggtpygastlagadgsrqpsenelqiarfqgkhvatia
krlannk

SCOPe Domain Coordinates for d4la4b_:

Click to download the PDB-style file with coordinates for d4la4b_.
(The format of our PDB-style files is described here.)

Timeline for d4la4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4la4a_