SCOPe 2.06: Domain d1au8a_: 1au8 A:

Lineage for d1au8a_ (1au8 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Cathepsin G [50548] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50549] (3 PDB entries)

8. Domain d1au8a_: 1au8 A: [26291]
   complexed with 0h8

Details for d1au8a_

PDB Entry: 1au8, 1.9 Å

PDB Description: human cathepsin g

PDB Compounds: (A:) cathepsin G

SCOPe Domain Sequences for d1au8a_:

Sequence; same for both SEQRES and ATOM records:

>d1au8a_ b.47.1.2 (A:) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]}
iiggresrphsrpymaylqiqspagqsrcggflvredfvltaahcwgsninvtlgahniq
rrentqqhitarrairhpqynqrtiqndimllqlsrrvrrnrnvnpvalpraqeglrpgt
lctvagwgrvsmrrgtdtlrevqlrvqrdrqclrifgsydprrqicvgdrrerkaafkgd
sggpllcnnvahgivsygkssgvppevftrvssflpwirttmrs

Timeline for d1au8a_:

• d1au8a_ first appeared (with stable ids) in SCOP 1.55
  
• d1au8a_ appears in SCOPe 2.05
  
• d1au8a_ appears in SCOPe 2.07
  
• d1au8a_ appears in the current release, SCOPe 2.08