SCOPe 2.08: Domain d4l7db1: 4l7d B:326-609

Lineage for d4l7db1 (4l7d B:326-609)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.11: Kelch motif [117281] (2 families)

5. Family b.68.11.1: Kelch motif [117282] (2 proteins)
   Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)

6. Protein automated matches [190126] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193097] (24 PDB entries)

8. Domain d4l7db1: 4l7d B:326-609 [262903]
   Other proteins in same PDB: d4l7da2, d4l7db2, d4l7dc2
   automated match to d4in4c_
   complexed with 1vx, act

Details for d4l7db1

PDB Entry: 4l7d, 2.25 Å

PDB Description: Structure of keap1 kelch domain with (1S,2R)-2-{[(1S)-5-methyl-1-[(1-oxo-1,3-dihydro-2H-isoindol-2-yl)methyl]-3,4-dihydroisoquinolin-2(1H)-yl]carbonyl}cyclohexanecarboxylic acid

PDB Compounds: (B:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4l7db1:

Sequence; same for both SEQRES and ATOM records:

>d4l7db1 b.68.11.1 (B:326-609) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rliytaggyfrqslsyleaynpsdgtwldladlqvprsglagcvvggllyavggrnnspd
gntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsveryep
erdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamnt
irsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitvhqgr
iyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

Timeline for d4l7db1:

• d4l7db1 first appeared in SCOPe 2.05, called d4l7db_
  
• d4l7db1 appears in SCOPe 2.07