Lineage for d4l1el_ (4l1e L:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979193Protein automated matches [190531] (18 species)
    not a true protein
  7. 1979253Species Leptolyngbya sp. [TaxId:574115] [256954] (1 PDB entry)
  8. 1979259Domain d4l1el_: 4l1e L: [262897]
    Other proteins in same PDB: d4l1ea_, d4l1ec_, d4l1ee_, d4l1eg_, d4l1ei_, d4l1ek_
    automated match to d4l1eb_
    complexed with bla, cyc

Details for d4l1el_

PDB Entry: 4l1e (more details), 2.61 Å

PDB Description: Crystal structure of C-Phycocyanin from Leptolyngbya sp. N62DM
PDB Compounds: (L:) phycocyanin beta chain

SCOPe Domain Sequences for d4l1el_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l1el_ a.1.1.3 (L:) automated matches {Leptolyngbya sp. [TaxId: 574115]}
mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs

SCOPe Domain Coordinates for d4l1el_:

Click to download the PDB-style file with coordinates for d4l1el_.
(The format of our PDB-style files is described here.)

Timeline for d4l1el_: