Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (18 species) not a true protein |
Species Leptolyngbya sp. [TaxId:574115] [256954] (1 PDB entry) |
Domain d4l1eh_: 4l1e H: [262896] Other proteins in same PDB: d4l1ea_, d4l1ec_, d4l1ee_, d4l1eg_, d4l1ei_, d4l1ek_ automated match to d4l1eb_ complexed with bla, cyc |
PDB Entry: 4l1e (more details), 2.61 Å
SCOPe Domain Sequences for d4l1eh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l1eh_ a.1.1.3 (H:) automated matches {Leptolyngbya sp. [TaxId: 574115]} mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs
Timeline for d4l1eh_: