Lineage for d4l08h_ (4l08 H:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843896Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843897Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 1843950Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 1843951Protein automated matches [190499] (20 species)
    not a true protein
  7. 1844011Species Pseudomonas putida [TaxId:1042876] [257820] (2 PDB entries)
  8. 1844021Domain d4l08h_: 4l08 H: [262893]
    automated match to d4l07a_
    complexed with mae

Details for d4l08h_

PDB Entry: 4l08 (more details), 2.66 Å

PDB Description: crystal structure of the maleamate amidase ami(c149a) in complex with maleate from pseudomonas putida s16
PDB Compounds: (H:) Hydrolase, isochorismatase family

SCOPe Domain Sequences for d4l08h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l08h_ c.33.1.0 (H:) automated matches {Pseudomonas putida [TaxId: 1042876]}
qkevydaagfgnpvsrgvhpaiivvdfsygftdlqyptasdaslqmsrtkeicdlarale
fpvifttiayhpgeipmlpwlekssgmaallygsrlveidmatgiqpndvvvvkkgassf
fgstlssllagtntdtvvvtgattsgavratvvdavqsgfkvlvpadccadrakgpheas
lydiqqkygdvtdsddilkwlrsvag

SCOPe Domain Coordinates for d4l08h_:

Click to download the PDB-style file with coordinates for d4l08h_.
(The format of our PDB-style files is described here.)

Timeline for d4l08h_: