Lineage for d4l08g_ (4l08 G:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122006Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2122007Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2122060Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2122061Protein automated matches [190499] (22 species)
    not a true protein
  7. 2122126Species Pseudomonas putida [TaxId:1042876] [257820] (2 PDB entries)
  8. 2122135Domain d4l08g_: 4l08 G: [262892]
    automated match to d4l07a_
    complexed with mae

Details for d4l08g_

PDB Entry: 4l08 (more details), 2.66 Å

PDB Description: crystal structure of the maleamate amidase ami(c149a) in complex with maleate from pseudomonas putida s16
PDB Compounds: (G:) Hydrolase, isochorismatase family

SCOPe Domain Sequences for d4l08g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l08g_ c.33.1.0 (G:) automated matches {Pseudomonas putida [TaxId: 1042876]}
qkevydaagfgnpvsrgvhpaiivvdfsygftdlqyptasdaslqmsrtkeicdlarale
fpvifttiayhpgeipmlpwlekssgmaallygsrlveidmatgiqpndvvvvkkgassf
fgstlssllagtntdtvvvtgattsgavratvvdavqsgfkvlvpadccadrakgpheas
lydiqqkygdvtdsddilkwlrsvag

SCOPe Domain Coordinates for d4l08g_:

Click to download the PDB-style file with coordinates for d4l08g_.
(The format of our PDB-style files is described here.)

Timeline for d4l08g_: