Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (26 species) not a true protein |
Species Pseudomonas putida [TaxId:1042876] [257820] (2 PDB entries) |
Domain d4l08e_: 4l08 E: [262890] automated match to d4l07a_ complexed with mae |
PDB Entry: 4l08 (more details), 2.66 Å
SCOPe Domain Sequences for d4l08e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l08e_ c.33.1.0 (E:) automated matches {Pseudomonas putida [TaxId: 1042876]} qkevydaagfgnpvsrgvhpaiivvdfsygftdlqyptasdaslqmsrtkeicdlarale fpvifttiayhpgeipmlpwlekssgmaallygsrlveidmatgiqpndvvvvkkgassf fgstlssllagtntdtvvvtgattsgavratvvdavqsgfkvlvpadccadrakgpheas lydiqqkygdvtdsddilkwlrsvag
Timeline for d4l08e_: