Lineage for d1a0ld_ (1a0l D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 14979Protein beta-Tryptase [50546] (1 species)
  7. 14980Species Human (Homo sapiens) [TaxId:9606] [50547] (1 PDB entry)
  8. 14984Domain d1a0ld_: 1a0l D: [26289]

Details for d1a0ld_

PDB Entry: 1a0l (more details), 3 Å

PDB Description: human beta-tryptase: a ring-like tetramer with active sites facing a central pore

SCOP Domain Sequences for d1a0ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0ld_ b.47.1.2 (D:) beta-Tryptase {Human (Homo sapiens)}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpkk

SCOP Domain Coordinates for d1a0ld_:

Click to download the PDB-style file with coordinates for d1a0ld_.
(The format of our PDB-style files is described here.)

Timeline for d1a0ld_: