SCOPe 2.06: Domain d4kyub_: 4kyu B:

Lineage for d4kyub_ (4kyu B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [256925] (2 PDB entries)

8. Domain d4kyub_: 4kyu B: [262886]
   automated match to d4kyua_
   complexed with gdp, k, mg, na, nh4

Details for d4kyub_

PDB Entry: 4kyu, 1.7 Å

PDB Description: crystal structure of n-terminal g-domain of enga from bacillus subtilis

PDB Compounds: (B:) GTPase Der

SCOPe Domain Sequences for d4kyub_:

Sequence, based on SEQRES records:

>d4kyub_ c.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
kpvvaivgrpnvgkstifnriagerisivedtpgvtrdriyssaewlnydfnlidtggid
igdepflaqirqqaeiamdeadviifmvngregvtaadeevakilyrtkkpvvlavnkld
ntemraniydfyslgfgepypisgthglglgdlldavaehf

Sequence, based on observed residues (ATOM records):

>d4kyub_ c.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
kpvvaivgrpnvgkstifnriaiyssaewnydfnlidtggidigdepflaqirqqaeiam
deadviifmvngregvtaadeevakilyrtkkpvvlavnkldntemraniydfyslgfge
pypisgthglglgdlldavaehf

Timeline for d4kyub_:

• d4kyub_ first appeared in SCOPe 2.05
  
• d4kyub_ appears in SCOPe 2.07
  
• d4kyub_ appears in the current release, SCOPe 2.08