Lineage for d4kyub_ (4kyu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871665Species Bacillus subtilis [TaxId:224308] [256925] (4 PDB entries)
  8. 2871670Domain d4kyub_: 4kyu B: [262886]
    automated match to d4kyua_
    complexed with gdp, k, mg, na, nh4

Details for d4kyub_

PDB Entry: 4kyu (more details), 1.7 Å

PDB Description: crystal structure of n-terminal g-domain of enga from bacillus subtilis
PDB Compounds: (B:) GTPase Der

SCOPe Domain Sequences for d4kyub_:

Sequence, based on SEQRES records: (download)

>d4kyub_ c.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
kpvvaivgrpnvgkstifnriagerisivedtpgvtrdriyssaewlnydfnlidtggid
igdepflaqirqqaeiamdeadviifmvngregvtaadeevakilyrtkkpvvlavnkld
ntemraniydfyslgfgepypisgthglglgdlldavaehf

Sequence, based on observed residues (ATOM records): (download)

>d4kyub_ c.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
kpvvaivgrpnvgkstifnriaiyssaewnydfnlidtggidigdepflaqirqqaeiam
deadviifmvngregvtaadeevakilyrtkkpvvlavnkldntemraniydfyslgfge
pypisgthglglgdlldavaehf

SCOPe Domain Coordinates for d4kyub_:

Click to download the PDB-style file with coordinates for d4kyub_.
(The format of our PDB-style files is described here.)

Timeline for d4kyub_: