SCOP 1.75: Domain d1a0lc_: 1a0l C:

Lineage for d1a0lc_ (1a0l C:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein beta-Tryptase [50546] (1 species)
   ring-like tetramer with active sites facing a central pore

7. Species Human (Homo sapiens) [TaxId:9606] [50547] (9 PDB entries)

8. Domain d1a0lc_: 1a0l C: [26288]

Details for d1a0lc_

PDB Entry: 1a0l, 3 Å

PDB Description: human beta-tryptase: a ring-like tetramer with active sites facing a central pore

PDB Compounds: (C:) beta-tryptase

SCOP Domain Sequences for d1a0lc_:

Sequence; same for both SEQRES and ATOM records:

>d1a0lc_ b.47.1.2 (C:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpkk

Timeline for d1a0lc_:

• d1a0lc_ first appeared (with stable ids) in SCOP 1.55
  
• d1a0lc_ appears in SCOP 1.73
  
• d1a0lc_ appears in SCOPe 2.01
  
• d1a0lc_ appears in the current release, SCOPe 2.08