![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d4kv5j1: 4kv5 J:1-245 [262879] Other proteins in same PDB: d4kv5a_, d4kv5b_, d4kv5c_, d4kv5d_, d4kv5e2, d4kv5g2, d4kv5h2, d4kv5j2 automated match to d4kv5f_ |
PDB Entry: 4kv5 (more details), 3 Å
SCOPe Domain Sequences for d4kv5j1:
Sequence, based on SEQRES records: (download)
>d4kv5j1 b.1.1.0 (J:1-245) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkkpgssvkvsckasgytfssnviswvrqapgqglewmggvipivdiany aqrfkgrvtitadeststtymelsslrsedtavyycastlglvldamdywgqgtlvtvss ggggsggggsggggsaletvltqspgtlslspgeratlscrasqslgssylawyqqkpgq aprlliygassrapgipdrfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgt rleik
>d4kv5j1 b.1.1.0 (J:1-245) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkkpgssvkvsckasgytfssnviswvrqapgqglewmggvipivdiany aqrfkgrvtitadeststtymelsslrsedtavyycastlglvldamdywgqgtlvtvss letvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgi pdrfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleik
Timeline for d4kv5j1: