Lineage for d4kuhe2 (4kuh E:184-280)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334665Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries)
  8. 2334682Domain d4kuhe2: 4kuh E:184-280 [262869]
    Other proteins in same PDB: d4kuha1, d4kuhb1, d4kuhc1, d4kuhd1, d4kuhe1, d4kuhf1, d4kuhg1, d4kuhh1
    automated match to d4kuga2
    complexed with caa

Details for d4kuhe2

PDB Entry: 4kuh (more details), 2.51 Å

PDB Description: crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
PDB Compounds: (E:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4kuhe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kuhe2 a.100.1.0 (E:184-280) automated matches {Clostridium butyricum [TaxId: 632245]}
gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd
vlynetgdtkyrassllrkyvragwlgrktgkgfydy

SCOPe Domain Coordinates for d4kuhe2:

Click to download the PDB-style file with coordinates for d4kuhe2.
(The format of our PDB-style files is described here.)

Timeline for d4kuhe2: