Class a: All alpha proteins [46456] (286 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (30 species) not a true protein |
Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries) |
Domain d4kugd2: 4kug D:184-282 [262861] Other proteins in same PDB: d4kuga1, d4kugb1, d4kugc1, d4kugd1 automated match to d3hada1 complexed with nad |
PDB Entry: 4kug (more details), 2.3 Å
SCOPe Domain Sequences for d4kugd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kugd2 a.100.1.0 (D:184-282) automated matches {Clostridium butyricum [TaxId: 632245]} gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd vlynetgdtkyrassllrkyvragwlgrktgkgfydysk
Timeline for d4kugd2: