![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (203 species) not a true protein |
![]() | Species Clostridium butyricum [TaxId:632245] [256900] (4 PDB entries) |
![]() | Domain d4kugd1: 4kug D:1-183 [262860] Other proteins in same PDB: d4kuga2, d4kugb2, d4kugc2, d4kugd2 automated match to d3hada2 complexed with nad |
PDB Entry: 4kug (more details), 2.3 Å
SCOPe Domain Sequences for d4kugd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kugd1 c.2.1.0 (D:1-183) automated matches {Clostridium butyricum [TaxId: 632245]} mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva eap
Timeline for d4kugd1: