Lineage for d1a0la_ (1a0l A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2794983Protein beta-Tryptase [50546] (1 species)
    ring-like tetramer with active sites facing a central pore
  7. 2794984Species Human (Homo sapiens) [TaxId:9606] [50547] (22 PDB entries)
  8. 2795020Domain d1a0la_: 1a0l A: [26286]
    complexed with apa

Details for d1a0la_

PDB Entry: 1a0l (more details), 3 Å

PDB Description: human beta-tryptase: a ring-like tetramer with active sites facing a central pore
PDB Compounds: (A:) beta-tryptase

SCOPe Domain Sequences for d1a0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0la_ b.47.1.2 (A:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpkk

SCOPe Domain Coordinates for d1a0la_:

Click to download the PDB-style file with coordinates for d1a0la_.
(The format of our PDB-style files is described here.)

Timeline for d1a0la_: