SCOPe 2.08: Domain d4kuec2: 4kue C:184-280

Lineage for d4kuec2 (4kue C:184-280)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries)

8. Domain d4kuec2: 4kue C:184-280 [262855]
   Other proteins in same PDB: d4kuea1, d4kueb1, d4kuec1, d4kued1
   automated match to d4kuga2

Details for d4kuec2

PDB Entry: 4kue, 2 Å

PDB Description: crystal structure of 3-hydroxybutylryl-coa dehydrogenase from clostridium butyricum

PDB Compounds: (C:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4kuec2:

Sequence; same for both SEQRES and ATOM records:

>d4kuec2 a.100.1.0 (C:184-280) automated matches {Clostridium butyricum [TaxId: 632245]}
gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd
vlynetgdtkyrassllrkyvragwlgrktgkgfydy

Timeline for d4kuec2:

• d4kuec2 first appeared in SCOPe 2.05
  
• d4kuec2 appears in SCOPe 2.07