| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries) |
| Domain d4kueb2: 4kue B:184-280 [262853] Other proteins in same PDB: d4kuea1, d4kueb1, d4kuec1, d4kued1 automated match to d4kuga2 |
PDB Entry: 4kue (more details), 2 Å
SCOPe Domain Sequences for d4kueb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kueb2 a.100.1.0 (B:184-280) automated matches {Clostridium butyricum [TaxId: 632245]}
gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd
vlynetgdtkyrassllrkyvragwlgrktgkgfydy
Timeline for d4kueb2: